NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066655_10001309

Scaffold Ga0066655_10001309


Overview

Basic Information
Taxon OID3300018431 Open in IMG/M
Scaffold IDGa0066655_10001309 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8906
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (61.54%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001093Metagenome / Metatranscriptome780Y
F009323Metagenome / Metatranscriptome319Y
F010455Metagenome303Y

Sequences

Protein IDFamilyRBSSequence
Ga0066655_1000130911F010455AGGLGKESEQTQHERAENTLLAIKEFKRYLEGVEKDLSRMSKRFSNKEIAHGVGFAATGIHEALTYLGIVKKVIEKTERIVAKSNIVSGNETAGQDEIHSDGRKSLSSST
Ga0066655_1000130912F001093GGAGMAISVDRAGRMITFESCRGLQIRNVFSDYNSAMCYEMASDTKSRESWDKQELSGKSISRMNPLKLSRVFRFNDPETGAPQISDFPDSNPTGDTPLEIRMKHFTEVENFTFLAYVLGHELGGTAPRPIRTVTDLEVPDDEFQNFVNTAKTVSVTDEELADSVLDVGINWEHFVASNDNLLLPDHPLKISDVLMQEKIDALDIITEAFVRELNLRSVEKQTGTKAKKGHD
Ga0066655_100013092F009323AGTAGGMVDTVVISTLYFISVFQLILQAGVVFYAYRVTKLTGSFRAWTLIIAAFTLLTVRNVVSLFLSLSLPAYQLGALIDSVGLVALILSSVVNMAAGVALFLGMFGLAKRFENQSKAPT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.