NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190275_10019556

Scaffold Ga0190275_10019556


Overview

Basic Information
Taxon OID3300018432 Open in IMG/M
Scaffold IDGa0190275_10019556 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5226
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Montana
CoordinatesLat. (o)45.2639Long. (o)-110.8632Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041055Metagenome160Y
F091338Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0190275_100195562F041055AGGAGMDEVSVTRSSPPSTKAIVANEDFCKQAAALLLCDRDPIHDAFVGEPVEEVLEMVRWALSHEDDEGFDTAGVLTSWAEKRGRGAWSDRPQRPERDPYEELARALGRYWKEHPGELAALLERTETSPNGRS
Ga0190275_100195563F091338GGAVAAREPEVHHAAPRCLLSLHEKANGITDLDGEAIQAWVEWEWEAMRWRVPVEISRSELEELVERSGELLEREHHRLLHDGDWRRWGSRGGRETLRRYGTDWFSLLALRRWGRITASELEAARVIR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.