Scaffold Ga0190275_11012326

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0190275_11012326

Scaffold Ga0190275_11012326

Overview

Basic Information
Taxon OID	3300018432 Open in IMG/M
Scaffold ID	Ga0190275_11012326 Open in IMG/M
Source Dataset Name	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	902
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location Name	USA: Montana
Coordinates	Lat. (^o)	45.2639	Long. (^o)	-110.8632	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039477	Metagenome	163	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190275_110123262	F039477	AGG	MDRLMRSWIKRLERHASEDLASFILEDGSRYYFNPTSAEIFLHSMDCLRAQGECEPFPEPPETVKAIASARDRASALNQLYPSGTFGIFPYEVEALVERGELVPRSLVAGRELGEPLENLSEP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.