NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066662_10002289

Scaffold Ga0066662_10002289


Overview

Basic Information
Taxon OID3300018468 Open in IMG/M
Scaffold IDGa0066662_10002289 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8992
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005842Metagenome / Metatranscriptome388Y
F013030Metagenome / Metatranscriptome275Y
F021350Metagenome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0066662_1000228912F005842AGGAGMTFLQFISKFHQEESGQDLLEYALVLLAVLAAVVTGSQNLATDIATGLTAINVKIQAAIAKA
Ga0066662_100022897F013030GAGMCDVPPNEPFVSADEAAQFLSVKRRYLLALARRGMAGAYPLGTGTKRKTWVFRLSELAASIMSDKTIISKTQKPCTIRSGSPR
Ga0066662_100022898F021350AGGAGMAILKSPPKPPKNETLQIRVEEAIRSKLSKYAEFIDSSESYVVSEALKPLFRKDDDFKTWLEEQNRNGDQRQNGGDSLFETVKKA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.