NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066662_10082373

Scaffold Ga0066662_10082373


Overview

Basic Information
Taxon OID3300018468 Open in IMG/M
Scaffold IDGa0066662_10082373 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2206
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008873Metagenome / Metatranscriptome326Y
F018886Metagenome / Metatranscriptome232Y
F069885Metagenome123N

Sequences

Protein IDFamilyRBSSequence
Ga0066662_100823731F018886N/ARTDPEFESKMFVSREKLVDAEERMIRSFGVQDSIIPIPELVLQLTKRQMESMGESFARQELVTDNEKEELVRLSYDYLDAAVERGLDPMMSYRGRAAGVMLRAVRDLGLQVSRVDIARAAGFDKGSMGVNANAIESLLKDLKSSENNGS
Ga0066662_100823732F008873AGTAGMTEKKKEDEKKPTKLPPFVDPQLFVAVEQANRRLKEIMKVAEPGEELYKSTQRITEVNEMLLRRQDQLRKLFEPSENLVKYLERIREMIEKLIRTKLSELPATSRTIIPQLEVEVSGYVEAFERALAEKQEEIETLKAELEALKSKRKPK
Ga0066662_100823734F069885N/AMSQTSAIILKFPDSKADEFERLFKAEVLPLWRKFKSEGKFLGASPTPIQGGMTARKGVRHYILHVEVPGMAEHEEFDSHPVFTKFLAKAQAMQAEDPLVWFGETLLQV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.