NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066662_10217985

Scaffold Ga0066662_10217985


Overview

Basic Information
Taxon OID3300018468 Open in IMG/M
Scaffold IDGa0066662_10217985 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1527
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000092Metagenome / Metatranscriptome2385Y
F004291Metagenome / Metatranscriptome445Y
F036398Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0066662_102179851F036398N/ATSYGGVRPGMHLWFGMDWDAAHSSGTTFMPVRRHISFGITQQFRLHR
Ga0066662_102179852F004291AGGAGMKTMKMAMLVLLGSIVVVPAATAQIKHIEMRVEGMT
Ga0066662_102179853F000092GAGVKQHLGRQSGVQNVEVSLRDGKVDVTPKEDGQIDPAQLLKATYDSGVTAAEMDVTARGKIVKDQSGGLALQVAPNRSFMLTPNELSKGLESLADTPTFVTVRGQLYQKPPGKKKPEPPATFKLLILEVLKKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.