NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190271_10256056

Scaffold Ga0190271_10256056


Overview

Basic Information
Taxon OID3300018481 Open in IMG/M
Scaffold IDGa0190271_10256056 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1786
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)41.109Long. (o)-111.7531Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020671Metagenome / Metatranscriptome222Y
F048823Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0190271_102560562F048823N/AMPNLDPGVNQNEDMTTKTINKFENHLLSIKTERQKMIHPNSHPTYNERQQKIIEMIDWTLEKYKTTANIKMTDQEKGEQEVIIIEDIIQELDKKRKII
Ga0190271_102560563F020671N/AMIIDNNKDDDYCWWNRILSELKCKGEIECYDKLNELHPKYPIIIYNHALRYKHRLKKIASTIKVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.