NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193064_1006107

Scaffold Ga0193064_1006107


Overview

Basic Information
Taxon OID3300018616 Open in IMG/M
Scaffold IDGa0193064_1006107 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)945
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameNorth Pacific Ocean: TARA_138
CoordinatesLat. (o)6.3305Long. (o)-102.9464Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000797Metatranscriptome886Y

Sequences

Protein IDFamilyRBSSequence
Ga0193064_10061071F000797N/ALFPCDASSVFSDKTVDIGGASTTAVTPTGDWKKYMRKDKPTKYLNTPVFMGAWKQIKAEGAYASFSWTIKADVPTVFLPGLLKSRLAQFPETPTGTYVETCNKVLMGYFGNLEVVSKTGMKRFLEQFEGYYANGGKCWRWDTPDCKKAWKYGPWGEDLFMQRTMDDAEVMKKSDFSLTDTGTCPGMRPKVNKDDTDFVPSCEGAYKFVAVHPFRNLTAWQTCYDTFSKRL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.