NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193577_112552

Scaffold Ga0193577_112552


Overview

Basic Information
Taxon OID3300018624 Open in IMG/M
Scaffold IDGa0193577_112552 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-5
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterWoods Hole Oceanographic Institution
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)501
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Deep Sea Water Colum In Eastern Mediterranean Sea

Source Dataset Sampling Location
Location NameEastern Mediterranean Sea
CoordinatesLat. (o)36.29Long. (o)15.39Alt. (m)Depth (m)2200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061214Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0193577_1125521F061214N/AVISARCRLVNGFANLTKIGLALKETPINGGLNDEGQTQSY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.