Basic Information | |
---|---|
Taxon OID | 3300018624 Open in IMG/M |
Scaffold ID | Ga0193577_112552 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-5 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Woods Hole Oceanographic Institution |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 501 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Deep Sea Water Colum In Eastern Mediterranean Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Eastern Mediterranean Sea | |||||||
Coordinates | Lat. (o) | 36.29 | Long. (o) | 15.39 | Alt. (m) | Depth (m) | 2200 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061214 | Metagenome / Metatranscriptome | 132 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193577_1125521 | F061214 | N/A | VISARCRLVNGFANLTKIGLALKETPINGGLNDEGQTQSY |
⦗Top⦘ |