Scaffold Ga0193226_1054660

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193226_1054660

Scaffold Ga0193226_1054660

Overview

Basic Information
Taxon OID	3300018835 Open in IMG/M
Scaffold ID	Ga0193226_1054660 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_N000000284 (ERX1782152-ERR1712198)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Canada's Michael Smith Genome Sciences Centre
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	931
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	Indian Ocean: TARA_047
Coordinates	Lat. (^o)	-2.0409	Long. (^o)	72.1645	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008536	Metatranscriptome	331	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193226_10546601	F008536	N/A	MGDHCKHPDTMVKGYGAKSSTTGRRYSVITPTGQDNAVGVKGFKGKCLCIVFYPKKDKFTQGVKAFAASQEKFNKEDCVVIACTADSNWSTWSTSLGLTLKGEMTATSLEKIKEEAFIPDPTSYDIPTVSLVMLDECSCIRHVMSTSLEPEEAVEAALSAAKTMNSCRLPDPDSLRKTTRERSFGKQKYDAFKRKSFYDLGLNTEQGQITLLGESELPAQIHLNFGKMLQATPAM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.