 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300018873 Open in IMG/M |
| Scaffold ID | Ga0193553_1008140 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2322 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Pacific Ocean: TARA_093 | |||||||
| Coordinates | Lat. (o) | -33.9116 | Long. (o) | -73.0537 | Alt. (m) | Depth (m) | 35 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000049 | Metagenome / Metatranscriptome | 3277 | Y |
| F008249 | Metagenome / Metatranscriptome | 336 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193553_10081401 | F000049 | N/A | TWGVLGADSRRTLIHPASQSSGLRMTFWQENYAFIKDVYDMRHQKMAEWMENVEKAIARIMADKVYTSAEFKRERDNFHALCKDLERTEVKKWLAHILEILMAERAKPEREKEYDALDKLIKKHEELIPWVSKISIKVDLYWKCYAYGDELKPHIEFLDGIMSSSTREIAPSCVENVDELIERQEKSLTQLENKRGIVKDLIDKGSVLLQNPDKPNFLESHQKRITEGWEDAKKKAQERLKLLQDTKAAWEGYAEGSETVANAFAKAEEEMGKIKKKRF |
| Ga0193553_10081402 | F008249 | N/A | LPRLRRRWARLRRNVFDRFPKRQEIYNKTKADLEAIYNKLKSDFETMALTLPEDKKKQLAKELADVTEKMGIVEKFGEKVKTIEDFCGNLELFDNTNKSLDDWMNRAAGELENIKTNSHTMCPEDRVAVCMELQEDIAAKVLLIEESIAKEQELLPQGEGVPSDALAHKEELERIHKFTLDLQEKVKQNTASFSEDVKFWAEYRTGIKEFTPWLTGAENEAKLGLGKPASLPEALALFDKISLFDKGCLRHEAVLKAAKEASLKMTTHKEADEQTSELFGRYTKVKAVSDGWMSKVDTLVKEWTLLDNTVTELNTWVAKDKTDEGENQFSLEKMESTLCELKNIFKEKEKLVDELDK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |