NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193610_1000869

Scaffold Ga0193610_1000869


Overview

Basic Information
Taxon OID3300018891 Open in IMG/M
Scaffold IDGa0193610_1000869 Open in IMG/M
Source Dataset NameSoil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 18 hrs after wetting v1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterQB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7670
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events

Source Dataset Sampling Location
Location NameUSA: Utah, Colorado Plateau, Green Butte Site
CoordinatesLat. (o)38.712053Long. (o)-109.695097Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005661Metagenome / Metatranscriptome393Y
F006886Metagenome / Metatranscriptome362Y

Sequences

Protein IDFamilyRBSSequence
Ga0193610_10008692F005661AGGAGMEYRVGKTGGAAHVTREFGYSPAQYGNLTPELVRDAARAAKTSDLQKQLATAMTRHLNKLYANKPEIERLTLEAIENGLRAKEEIDQYVKKALVASAKHDQHIVNLNHKLQQELGLIKVEGASTQTLANADFRQRLLLMRANHQAKGQIQQNSFQQSLKAIQASPQQAIAMQQKRTAFANYINAKDFDPIPAVPSGSAGGNGSIASNNGKGFLGGLFDFFSGRK
Ga0193610_10008693F006886N/AMYSSEFDSDFDYLNSATPQQFEQPNQPGKPEVTNIERFWNLTGNWGEFGSYFGAGLSASLIVRAIPALIPAAVILIPAAGLGLAVYTLTADGSAKLRSQLILIAVATALLSANWDAWLAWVIANSQLLIFGFAVTVITLAFVGVQVWSKLNVSK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.