Scaffold Ga0193548_10005741

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193548_10005741

Scaffold Ga0193548_10005741

Overview

Basic Information
Taxon OID	3300018907 Open in IMG/M
Scaffold ID	Ga0193548_10005741 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX1399744-ERR1328122)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Canada's Michael Smith Genome Sciences Centre
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1025
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_151
Coordinates	Lat. (^o)	36.139	Long. (^o)	-28.9598	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052865	Metagenome / Metatranscriptome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193548_100057411	F052865	AGAAG	MDLRGLGVVVLGLGLPSVAGYLTNTAIGARVMGYVDMVPGMSTNVGKAVSAIALTAGVSYLAASLGAISASEALTANMIALGLVSVGVLKTMSLPYGQGMVDALPSAGGLAGLGSYGYIGSYHMSGGHDHGMG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.