NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193591_1109621

Scaffold Ga0193591_1109621


Overview

Basic Information
Taxon OID3300018915 Open in IMG/M
Scaffold IDGa0193591_1109621 Open in IMG/M
Source Dataset NameSoil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 0 min after wetting v1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterQB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)868
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Tychonema → unclassified Tychonema → Tychonema sp. LEGE 06208(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events

Source Dataset Sampling Location
Location NameUSA: Utah, Colorado Plateau, Green Butte Site
CoordinatesLat. (o)38.712053Long. (o)-109.695097Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006886Metagenome / Metatranscriptome362Y
F069716Metagenome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0193591_11096211F006886N/AYARFFCMYSEFDSDFDYLNSETPQQFEQQNQAKAPEVTNIERFWTLTGNWGEFGSYFGVGLSASLIVRAIPALIPAAVILIPAAGLGLAVYSLAVDGAEKLRSQLILIAVGTALIAGNWDAWQAWIIANSQMLIFSFMVIVITLGFVAAQVWSKLNNAK
Ga0193591_11096212F069716GGAGMLSNINQPIVAGLLSASIAGIVAATALPFNDRIEYKIGNRIDSQPAWLVPPKAEFRSLERGYGGIKILLALLSTGGMFLTMLRARSEGEQEPVRQRIKQYKNRAYEFGYAAESAYQMSTTATRYKKLAEADE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.