Scaffold Ga0193591_1125023

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193591_1125023

Scaffold Ga0193591_1125023

Overview

Basic Information
Taxon OID	3300018915 Open in IMG/M
Scaffold ID	Ga0193591_1125023 Open in IMG/M
Source Dataset Name	Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 0 min after wetting v1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	QB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	791
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → unclassified Microcoleus → Microcoleus sp. FACHB-SPT15	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events

Source Dataset Sampling Location
Location Name	USA: Utah, Colorado Plateau, Green Butte Site
Coordinates	Lat. (^o)	38.712053	Long. (^o)	-109.695097	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026168	Metagenome / Metatranscriptome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193591_11250232	F026168	AGGGGG	MTTASEYTRPQPPLSFEAQLKALPPTVRSVAESLALRDMESAKRYAALYLSANRGVRS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.