NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193593_1128699

Scaffold Ga0193593_1128699


Overview

Basic Information
Taxon OID3300018939 Open in IMG/M
Scaffold IDGa0193593_1128699 Open in IMG/M
Source Dataset NameSoil crust microbial communities from Colorado Plateau, Utah, USA - midlate stage, 9 hrs after wetting v1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterQB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)621
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events

Source Dataset Sampling Location
Location NameUSA: Utah, Colorado Plateau, Green Butte Site
CoordinatesLat. (o)38.712053Long. (o)-109.695097Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075763Metagenome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0193593_11286992F075763GGAGGVHLSSDYIHPYKDAGGRAARCRVQIYLPDDVLDARVVVCSELSNNPDGSVTNSAEVIAAGVIRANKLPTPLVWIEHRPE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.