Scaffold Ga0193560_10139900

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193560_10139900

Scaffold Ga0193560_10139900

Overview

Basic Information
Taxon OID	3300018958 Open in IMG/M
Scaffold ID	Ga0193560_10139900 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Canada's Michael Smith Genome Sciences Centre
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	774
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	North Atlantic Ocean: TARA_144
Coordinates	Lat. (^o)	36.345	Long. (^o)	-72.7586	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026790	Metatranscriptome	196	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193560_101399001	F026790	N/A	MRILALLFIAATSSAKFSKEGGKPDGGLYFDEGEVALACTAGTGMGAKLSAAMESCVNTAGEEAVEIIEEQAATTSKKKPCRGRRCSTKFSKKCPSVQNVKKNMKEEMKVDLCILNKLGWIDASGDAIEEVMVEDIKTLPSEVSDNLNKENMSACAQKIVSKVSKHHERCAEKKKYSSDDVAQLSEIFLKTASYKCFQRQFAKSCQEFVRKEIYAFYKAKMTPALA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.