Basic Information | |
---|---|
Taxon OID | 3300018964 Open in IMG/M |
Scaffold ID | Ga0193087_10222522 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 601 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota → Saprolegniales → Saprolegniaceae → Saprolegnia → Saprolegnia parasitica | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Indian Ocean: TARA_065 | |||||||
Coordinates | Lat. (o) | -35.2421 | Long. (o) | 26.3048 | Alt. (m) | Depth (m) | 30 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011083 | Metagenome / Metatranscriptome | 295 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193087_102225221 | F011083 | N/A | STSDIIAASRVQDALRALPNEVLECVSVKARTSSTVSLCTRFYDGVQHLGGYSETTDGAFKNSKMTTNFCETTYQLATATNKMDFTIEFADKPGQTGVQYLMEVDINKRGAGSFPVSGGITGGAYSVAEMNFNTNLGNLSELAECSDRGLDDGDGACECFDGFRGLACEEQEALV |
⦗Top⦘ |