NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187843_10026021

Scaffold Ga0187843_10026021


Overview

Basic Information
Taxon OID3300019093 Open in IMG/M
Scaffold IDGa0187843_10026021 Open in IMG/M
Source Dataset NameOligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2982
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.008Long. (o)-89.701Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005705Metagenome / Metatranscriptome392Y
F010227Metagenome / Metatranscriptome306Y
F010760Metagenome / Metatranscriptome299Y

Sequences

Protein IDFamilyRBSSequence
Ga0187843_1002602110F010227GGAGMQATQFNVSNKLTLANTDTDEDIISTTYDCNVEVQLAGDSAWDCEIEAVTVTSIHIHESFDEDGDSSIHITVCYNVDGDAEYEGSWRLYTDSGFEEAISELLGTTVFFTEQGMQEDGYASME
Ga0187843_100260212F005705AGGAGMKIVIKVPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRNPKHKGREQ
Ga0187843_100260218F010760AGGAGMLNIDKIVKVYNGKIGCMCGCNGKYSYTAKGAVENSPGYDVTDSINERSVRIITKKILSNPLVKFEDNYAYVEDRARNKMQMVVFKEPQEVFSPFDTVNS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.