NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187843_10067651

Scaffold Ga0187843_10067651


Overview

Basic Information
Taxon OID3300019093 Open in IMG/M
Scaffold IDGa0187843_10067651 Open in IMG/M
Source Dataset NameOligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1663
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.008Long. (o)-89.701Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007163Metagenome / Metatranscriptome356Y
F075746Metagenome118Y
F091317Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0187843_100676512F007163GGAMTLEDLQYIFEYQIEEGTENLYFMLTDGDRQPLIQRHPADKLADLLPMLDSFQYTGHNVMPRFAK
Ga0187843_100676513F091317GAGGMKVGGIDPAMAHNIELAKLTQQQTIKQQQLKVIEDRQEEIKQMRPKDPGKGANIDEMV
Ga0187843_100676514F075746N/AMNIFIPVLIICLNGNCEFMQAQTYYKNEAQCRASMEMQKQHMRNLVKEANRGDAEVLEGTCIDANIKTTPGRVS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.