NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188835_1004001

Scaffold Ga0188835_1004001


Overview

Basic Information
Taxon OID3300019096 Open in IMG/M
Scaffold IDGa0188835_1004001 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1489
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)62.09708Long. (o)18.5427Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037191Metagenome / Metatranscriptome168Y
F037722Metagenome / Metatranscriptome167Y
F086835Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0188835_10040013F037191GAGMTVAEWIEKLKTFPQDQEVRITDGHKYNFYEGDFNFQLFEDVDGSTFVDIGIGGFEELK
Ga0188835_10040014F037722GAGGMTKHEIGATIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLINVLE
Ga0188835_10040015F086835N/AMTKEIDISTVLIDGDQVTIMGVKYQRIIEPQSFYDEIYGLLNPNLDERVDTGEITVRVLDLIRENIPEPVVYDGEEYDMGWNDAIQKVNEGLFE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.