Scaffold Ga0193604_1019923

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193604_1019923

Scaffold Ga0193604_1019923

Overview

Basic Information
Taxon OID	3300019132 Open in IMG/M
Scaffold ID	Ga0193604_1019923 Open in IMG/M
Source Dataset Name	Soil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, 49.5 hrs after wetting v1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	QB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1068
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events

Source Dataset Sampling Location
Location Name	USA: Utah, Colorado Plateau, Green Butte Site
Coordinates	Lat. (^o)	38.712053	Long. (^o)	-109.695097	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023527	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193604_10199232	F023527	AGGAG	VAALFCSCEQQRPIWGEFWWVEGKYQWVFFDEQERSETYTERLTHCPACGQSLERMNLVDAVKG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.