Basic Information | |
---|---|
Taxon OID | 3300019149 Open in IMG/M |
Scaffold ID | Ga0188870_10116314 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dT |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 631 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 54.570232 | Long. (o) | 11.332183 | Alt. (m) | Depth (m) | 19 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050877 | Metatranscriptome | 144 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0188870_101163141 | F050877 | N/A | RHQRTSSNTMIARGILVLVCVHLGSCLEIEVGRDSNVYPLFLNPFDVTHWKCLGYTVYENTDKSALYTYDVDVCFAAVLAAKLGFPWIYEYFTGNNFFQAVGLVSRSGQDYYSDYSSEDVTDFSSPSFSEKASELFNEMGKAVHRDPSPYSGVNRYNRVPKQF |
⦗Top⦘ |