NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182075_1498395

Scaffold Ga0182075_1498395


Overview

Basic Information
Taxon OID3300019282 Open in IMG/M
Scaffold IDGa0182075_1498395 Open in IMG/M
Source Dataset NameMetatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)592
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008856Metagenome / Metatranscriptome327Y
F044214Metagenome / Metatranscriptome155N

Sequences

Protein IDFamilyRBSSequence
Ga0182075_14983951F044214N/AKENKVDLQDEIRILKLQLGNLEVQIADYQQIVKELSDKLRLYEEINGSVFRPARK
Ga0182075_14983952F008856N/AQQQVRRMYSHPDPDLDLEDEFWPLMGIFVAILLGWTGLIHLIDWLTFDTIPLWMEPFTITPLIFLVVMKERYDSINPLHWWPMFWGYHCPLPEEDHITIRPLEAEDVLKKYGGRMNVFIVDHEHIKFRRRKDAVMFGLTNTIF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.