NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190264_10017002

Scaffold Ga0190264_10017002


Overview

Basic Information
Taxon OID3300019377 Open in IMG/M
Scaffold IDGa0190264_10017002 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2346
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)38.0262Long. (o)-109.5407Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004746Metagenome / Metatranscriptome425Y
F023705Metagenome / Metatranscriptome209Y
F035469Metagenome / Metatranscriptome172Y

Sequences

Protein IDFamilyRBSSequence
Ga0190264_100170021F023705AGGGGGLLESHEARIGTSVGVLDGSKRTGKGRVGTIERTYGHPNYLAVEVRFEDGSVELYWYHELRTMAQQPLA
Ga0190264_100170022F004746AGGAGGVQANEARRGTIVWVREGHWKSQFAGMRGTVQNCWGNSEHAAVDVLLEDGRSELFWLSDLSVVDEDIAV
Ga0190264_100170023F035469GGTGGMDRHHGFWLPFGYYLDLDADLLMLRRSDGSFVAAFSASGADLFEVELMAWEDAD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.