NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190264_10912918

Scaffold Ga0190264_10912918


Overview

Basic Information
Taxon OID3300019377 Open in IMG/M
Scaffold IDGa0190264_10912918 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)688
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)38.0262Long. (o)-109.5407Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027433Metagenome / Metatranscriptome194Y
F030161Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0190264_109129181F027433N/AGRKLTVDLPNNGGRSTAAFYFINGRIVSLQATVLPANGDYETPEMGRFIDSITFFAVRAADDAIELPPPG
Ga0190264_109129182F030161GGAGGMQKWMLAALSGVALTIATVPVQAQSGWKSYIVKDLGFSFMAPGEVKAEVGTFRGAIAGPRQTMVFKSVVNNIEYKVTAMTFLQAQAEGATILGERSFMFQEDRTIVVDTFARVEPGKDAVYGRKMVVDLPDNKGRATGAFFFT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.