Scaffold Ga0187892_10003979

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187892_10003979

Scaffold Ga0187892_10003979

Overview

Basic Information
Taxon OID	3300019458 Open in IMG/M
Scaffold ID	Ga0187892_10003979 Open in IMG/M
Source Dataset Name	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	25773
Total Scaffold Genes	24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	17 (70.83%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location Name	USA: the Island of Hawaii
Coordinates	Lat. (^o)	19.0643	Long. (^o)	-155.8008	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018747	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187892_100039796	F018747	N/A	MTLNKAAFLALVGMILATILLVGGFIGDVFSVARGLIPAMRLLTSFIYAFAGLSIVMFLYAFHKAQS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.