NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194024_1003162

Scaffold Ga0194024_1003162


Overview

Basic Information
Taxon OID3300019765 Open in IMG/M
Scaffold IDGa0194024_1003162 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3375
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (22.22%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025731Metagenome / Metatranscriptome200Y
F027834Metagenome / Metatranscriptome193Y
F027835Metagenome / Metatranscriptome193N

Sequences

Protein IDFamilyRBSSequence
Ga0194024_10031622F027835N/AMKTQRQIDALYERMKTAGGFECALIMAYMKADNGNARLLEDAFRGTRFDLLPKPRFDHGIETLRAAVRWADMRDEGYNFDKTAEELLQEYEIWADCTDEQPIDQHFLTRLQ
Ga0194024_10031623F027834N/AMKQLTFDEAMCFAYGSTMLTGGSSVGVMDNGEYYVPKYGYVVGGIVPEKSCDMDNESAFKHLYNRLFYQAGLELNQSGSAVIGTWVEDGKIVFDLCNVLDDMKDALELAAKRGERAIYDLEEQREIFVNYK
Ga0194024_10031625F025731N/AMPNSTTTQRKKAQMASALFNDVQLLGSTLTCTAEWDALCCDEQMRLEDLIGTGNV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.