NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181359_1021237

Scaffold Ga0181359_1021237


Overview

Basic Information
Taxon OID3300019784 Open in IMG/M
Scaffold IDGa0181359_1021237 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2458
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1881Long. (o)-86.344Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023107Metagenome / Metatranscriptome211Y
F043392Metagenome / Metatranscriptome156N
F066766Metagenome / Metatranscriptome126N
F091353Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0181359_10212372F043392AGTAGGMEIVDKYYHSNGSAVPFIAALVDDPADGDTKIVIMFDERDFTAVFSLDSLLRDEDISARNNGYHGDKYEKLREDLWDGFLD
Ga0181359_10212373F091353GGAMTKTAVDLFDEVCNAIDRGDLDKQLIPLKRIIEGRFLLVSVYPDIKDFIVGDRVVLNDKCGTKSLIGEEGTVVAIRRSKITITFDKPKGRFARTNSKGEIYSANAVVSVSIVDKI
Ga0181359_10212375F023107AGGMDNILPSRTVMFVGDYFTLMTTIVLDEKLRNEGEADNDFAVRVASVFMNEYYGFDVASVANSIGVVDEEGVEV
Ga0181359_10212376F066766AGGAGMAIKEVELEYTVDTLAKLVRDNYGKNAVEYLVGRLTSVITEKQLKVLIDYEKGVNG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.