NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182031_1045063

Scaffold Ga0182031_1045063


Overview

Basic Information
Taxon OID3300019787 Open in IMG/M
Scaffold IDGa0182031_1045063 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1099
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000078Metagenome / Metatranscriptome2550Y
F024149Metagenome / Metatranscriptome207Y

Sequences

Protein IDFamilyRBSSequence
Ga0182031_10450631F000078GGAGGLDHLYCLRCNRELEAGQKSVAVFLFAQTVGVRPRQKSSAQRICFCPQCSVSLAMGPAPEGALNLAAWQMIRDIVGADPALTEAAWESLHGIEEGLLPATGTNGSAHPARAGSYLEF
Ga0182031_10450632F024149GGAVENVRCLRCNRELESGRKFVAIYMFAQTVGIKPRQKSAAQRIVFCPQCSVSLALGLAPEGALNIAAWDMIRDLVSSDPALNQAAWENLRGVVRLLEAAEAQPEILPEPEPKPRSDAWVNFSRAG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.