NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137408_1277132

Scaffold Ga0137408_1277132


Overview

Basic Information
Taxon OID3300019789 Open in IMG/M
Scaffold IDGa0137408_1277132 Open in IMG/M
Source Dataset NameVadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2252
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016091Metagenome / Metatranscriptome250Y
F082855Metagenome113N

Sequences

Protein IDFamilyRBSSequence
Ga0137408_12771322F082855AGGMSAPAPALAKAPRRTVTVRLADVAVTVAYLSLIFGFLLVSFPVSFARIIQNSWLNGNLTVAMMVIALSIDACLYVRIAYRLSAKPTVLAAACLGFLPIVVVAGLSSCLQGAVNYTVSGDLPNLQARVGEEILAHTYLGLVSGIFLPFLVIRLLQQLKAARSNRETESPSQTAASVSSY
Ga0137408_12771323F016091GGCGGMSIKWLLWISLYLILAVFVPWATSLAWAHQHGSDLRPRPKQLFERGELGLVGLVLGISVIWDLLQSQYMPQTRALGSVLLAVSGTMAGAVWIETYCRHSTGMRSNPERAWRDSRNLAFFVFSLAVVIEILLDRFAKVTAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.