Basic Information | |
---|---|
Taxon OID | 3300019826 Open in IMG/M |
Scaffold ID | Ga0197828_1005897 Open in IMG/M |
Source Dataset Name | Microbial mat bacterial communities from Rhone River delta, Camargue, France - 2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Barcelona |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 538 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Microbial Mat → Microbial Mat Bacterial Communities From Rhone River Delta, Camargue, France |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rhone delta, Camargue, France, EU | |||||||
Coordinates | Lat. (o) | 43.6 | Long. (o) | 4.6 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033261 | Metagenome / Metatranscriptome | 178 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0197828_10058971 | F033261 | N/A | GKHEPLPGHSATRLCAETRRDEQGQLVREVEEDDTAFFLSAWLRCLVFNLMTRFAQAMGGKYTKMWAGTLLRKFIRRPATLYLIDKELHVVFDPFPDQDELQPLLDELNAKRTALPWLNNLVVQFRIADEEPLHPLTEPEKRNRLFGDG |
⦗Top⦘ |