NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193715_1003669

Scaffold Ga0193715_1003669


Overview

Basic Information
Taxon OID3300019878 Open in IMG/M
Scaffold IDGa0193715_1003669 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3331
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9355Long. (o)-106.9424Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032974Metagenome178Y
F074798Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0193715_10036691F074798GGAMVHGRYGEYRILVDGETVIDGGALTVLGIVPARRKAVEAVRAHLSRRPGPSSKDR
Ga0193715_10036692F032974N/AMIRLAVIGALGFPAALALAQQGETAGRLHLGQPDRSKPVPAKSEVIAAWQKRQSAVNTFRFAWTEEQTHPKGWLSNPRYPERERSAIPGLLIDRSYVVAKTLAVAGNKMRYSFELDRKEEPDGVDVVARQGSNRGLGVRRHYSYVTVFDGRIGTTRLSSFLDHPPETSTQTTSNIDAQNLDTRPILMAFRPLDPVMGHRLIDRAITNLSRTFYRGKSTFLLEERHDPSGWKTLLWIEPERNFLVSRYVMSFEQKMIVDINIDYLQDARWGWIPSGWRVTEMLSDGSRRVVSVAKVTSYSINVPIGTETFR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.