NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193751_1000871

Scaffold Ga0193751_1000871


Overview

Basic Information
Taxon OID3300019888 Open in IMG/M
Scaffold IDGa0193751_1000871 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20848
Total Scaffold Genes33 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (45.45%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8924Long. (o)-106.9111Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047255Metagenome / Metatranscriptome150Y
F092949Metagenome / Metatranscriptome107Y
F094192Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0193751_100087110F047255N/AMGAKGNLMEPAVAFRVREHDQGPVLEVRVNFGVLTSREATRAEIDDLAHALRGLAPSFEIVSEQRHEFGNDVEASLHQVVIEMAAVDDSVAMDVVGAADRWARACFEARHLDL
Ga0193751_100087120F092949N/AMAASSSSSSAGSSRADELWRRVGEAVGPAGEPTPLIEKVREHAWRITDADVAGLDADALYEAVLPVAFAVADEKRRRAYEAIDAH
Ga0193751_100087130F094192N/AMSSFRPKARTTGPDGREWEIYAYRKRAPAPPGRFRRGRRLFARRSGDWTIEASSWAPYPITHRWSTTPELRGQVLASVEGQLARGEAPQPRNAKQILN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.