NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193728_1002890

Scaffold Ga0193728_1002890


Overview

Basic Information
Taxon OID3300019890 Open in IMG/M
Scaffold IDGa0193728_1002890 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8761
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9225Long. (o)-106.9538Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009834Metagenome / Metatranscriptome312Y
F059222Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0193728_10028903F009834AGGAGGMNKMRKSKLTASKLSLVALLIIVLLMSLVSASARKRKVKQSENEAHVVAHISFSGLSIVDMAMQRKVNDKYYLYVQHSKDEGVSIIDVTKPAQAKTLGLISWPDPAVSSRMNVTGNLAIIAESEMLPMRGRRSTSNDDLVLWDLSNPAAPRVVQKFTGVVKWLQDERNFIYVLNRDGLWVVSEPADLQPEQTAPPTYGD
Ga0193728_10028907F059222AGGAGVGLGTEMLFMLVLGLLLLGPKRLPAILAHVARAKARFENATRSFKSQLEAELEADHHNGQTESPQETVGHQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.