NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193755_1000093

Scaffold Ga0193755_1000093


Overview

Basic Information
Taxon OID3300020004 Open in IMG/M
Scaffold IDGa0193755_1000093 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)24078
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (51.72%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9763Long. (o)-107.0041Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001466Metagenome / Metatranscriptome689Y
F013080Metagenome / Metatranscriptome274Y
F013440Metagenome271Y

Sequences

Protein IDFamilyRBSSequence
Ga0193755_100009315F013080GGAGGMSRIRALFTLLVVAFALSTVACADATGPRHGCDINNSNTCH
Ga0193755_100009322F013440N/AVSPTYRMLHAATRRREAEFAEVAQALAAARCAARLAGLGTGEFVVRELLLSVIDEINRAERAVASLVSTVSRDVVA
Ga0193755_100009328F001466GAGMLTEAGPGIRARSRFRPVYWVMRSIRTALLLTAMLPATAVPQTPPGPARPTLSAPVYRGFTPGISYRAFLERARTLADSDVVRCQTSPRTAQVMECGVVIRGPNDASRFYLSAHFVEGNADVVAFYDSAGFGDKRGVPLVDRTKKELTRLFGRPRPIGKSGWEWRYGRRAVRFNWRGRGTARWVSITLMDRDVMDRISAYVKPPIRKKT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.