Scaffold Ga0193755_1000117

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193755_1000117

Scaffold Ga0193755_1000117

Overview

Basic Information
Taxon OID	3300020004 Open in IMG/M
Scaffold ID	Ga0193755_1000117 Open in IMG/M
Source Dataset Name	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	21797
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (58.82%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location Name	USA: East River, Colorado
Coordinates	Lat. (^o)	38.9763	Long. (^o)	-107.0041	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005474	Metagenome / Metatranscriptome	399	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193755_10001177	F005474	GAGG	VAHQKLTADQLRRIEEIEEFRRAADHLNRLVTELEGNRAGQTRTIQQLSEKIANEASQMRQRALTANVGTIADVAGTMSVMAGRGGGINMKVRALADSVNSLYMQLDAAMKQATTPPEPKKPA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.