NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193755_1036945

Scaffold Ga0193755_1036945


Overview

Basic Information
Taxon OID3300020004 Open in IMG/M
Scaffold IDGa0193755_1036945 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1610
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9763Long. (o)-107.0041Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000173Metagenome / Metatranscriptome1777Y
F001983Metagenome / Metatranscriptome608Y
F026729Metagenome / Metatranscriptome197Y

Sequences

Protein IDFamilyRBSSequence
Ga0193755_10369451F026729N/AMPWDIALIFFLLGVVLPWRGRARMKKLLDMPQVGTLERLVLYASTMGFQWLAAAVVAWRAWAHGYSAEQLGWTIDGRAKILVASLVGAV
Ga0193755_10369452F001983AGGAMTRKNTWAGLAVAVGLSMPLMACKDTKTLEENAQLKAHVAELQKENGQLGNELETITAARDALTKENEALKTQMKTRKTKRSGKKPATRARPRR
Ga0193755_10369453F000173GGAGMKSFEVQFRYQDRTEGTVESTVKVDASSLPGGVAKATREFVKGLDRKQRFDMNKNGLEITAKSGGTTTEAQPKTSTEAAAG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.