NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193735_1115550

Scaffold Ga0193735_1115550


Overview

Basic Information
Taxon OID3300020006 Open in IMG/M
Scaffold IDGa0193735_1115550 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)735
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9228Long. (o)-106.9541Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002523Metagenome / Metatranscriptome552Y
F004910Metagenome / Metatranscriptome419Y
F005165Metagenome / Metatranscriptome410Y

Sequences

Protein IDFamilyRBSSequence
Ga0193735_11155501F005165N/AVGNDAAQPEWRQLCQAALFETDSVKLLERIAHARNAVLDRIEDGYSKPPTSEQAALREALSTLDSLRRITERQNGYQSKAS
Ga0193735_11155502F004910GGAGMAISQRLVDPYREFKVSVRYSWQESYHAALLETNWTRMVELVQAAESEIHKRRLQLSKDHQGTHAEREAVVNALNGLRVLRMDAAAWREQQNLK
Ga0193735_11155503F002523AGCAGMLVIVSVSRLDNDRIEVGVARPQHDSNPTNNYPSEKEARAVLSDFGISEEIMASHLKLLAQMGASEQLKFP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.