NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193726_1000044

Scaffold Ga0193726_1000044


Overview

Basic Information
Taxon OID3300020021 Open in IMG/M
Scaffold IDGa0193726_1000044 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)259075
Total Scaffold Genes246 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)190 (77.24%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9871Long. (o)-107.0011Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001678Metagenome / Metatranscriptome653Y
F027575Metagenome / Metatranscriptome194Y
F083081Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0193726_1000044231F001678GGAGGMRHIFVWVVEFIKLLGGRRLHPIATQCPICQQMVHLHVDKAGRRHVFAHARGLYEGSRFGVHYAAKMKCVGSGAQTMFDPRPDEHQSFKLPRSLLDES
Ga0193726_100004452F083081GGAMAYQPSWNEDEPPKDRQVLALAFAKAIKSGSGNLVRVVAAWVESNQEWRPVRVGGDTIAGTDLDVICWAELPEIPDTVGRLKKATPSRPTQVYPRPK
Ga0193726_100004465F027575N/AMIGAAALIAWMLIVRVDDLVKDGAKRRRLWRSTILDKIINANTVPFKRSRPLSGPSGRH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.