NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193726_1000083

Scaffold Ga0193726_1000083


Overview

Basic Information
Taxon OID3300020021 Open in IMG/M
Scaffold IDGa0193726_1000083 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)165989
Total Scaffold Genes160 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)127 (79.38%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9871Long. (o)-107.0011Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019506Metagenome / Metatranscriptome229Y
F020045Metagenome / Metatranscriptome226Y
F040201Metagenome / Metatranscriptome162Y
F062014Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0193726_100008323F020045GGAGMLRGVLGVLAGVFLWAAGFFVLAMGLAQLWPDYAVHGRQWTRENLFTFTPLMACCNLAFWVLAEIAAGWVTAKIAKRHEAVWVVAALLGIYLATLHLVLYWSRFPWWYNLGVVIPVVPAVLFGGRLASPPRGADLHARR
Ga0193726_100008326F019506GGAGMRLISSLMVCLALSACATDYVSQLYQPNYGVRGLKYTESNIDPTLLMNGSYASKQTNGYYGSSAFCLTDYRCSSLAQQRSSGWDP
Ga0193726_100008383F040201AGGAGMTTRISAKLTALAIALMMNGFIVGGVAYLFDAQTQAHLSVISFAKQLAAFQWLI
Ga0193726_100008385F062014GAGMGFDVVLIAIIVGGIALSGAYVRAEYLGWRQHGAAQRRREAAQSQLHAESLSDQRDALLPSVMKLQGFGESEAANPDDLDLAAARRSSGPSNSPRSYALAERRKRTRKRATH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.