NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207193_1000035

Scaffold Ga0207193_1000035


Overview

Basic Information
Taxon OID3300020048 Open in IMG/M
Scaffold IDGa0207193_1000035 Open in IMG/M
Source Dataset NameMicrobial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Minnesota - Twin Cities
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)201835
Total Scaffold Genes330 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)210 (63.64%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment → Sulfate-Impacted Lake Microbial Communities From Northern Minnesota

Source Dataset Sampling Location
Location NameLake Manganika, Minnesota, USA
CoordinatesLat. (o)47.489552Long. (o)-92.573009Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018701Metagenome / Metatranscriptome233Y
F039534Metagenome / Metatranscriptome163Y

Sequences

Protein IDFamilyRBSSequence
Ga0207193_1000035108F039534N/AMYNREKIINVMHEIHNESKSIDPYVVVAQPRRSAEDIPAQNFDGHTNLHVNFNGFSHGFCNIFGEKVDVARNYLIDQVIESGAKYMFFIGEDTVVPYEAFTELHKTAEANPNAIVAGVYYIKISNAMIMVREKNWISVANVDPGQVFEAWQTGMDCLLMPVEILKRLRDEDPEIPFCCIGNEIDGIPFIGEDNFFVHRIRKMGVKLLVNTDVQCLHADLANGKYTAHPSVDLTNYYTNIKITEPLTMKDKAYIDDRWASRIPAGTGAQK
Ga0207193_100003547F018701N/AMETMSAVSDKYEKDVADNVNKIPGVLSVRPPGDTAYADVKITYKSVTAWMEVKMNHTDNLSNPRVYYHSGIWQTTYKTPSAKAAIDILNADPKTKTFLQALAKFCGIPFKDIKIPTTKSGLKEPGAVPLETMKRFFAQPGINRYIANKERMDLGKIVTDHYTLGKAEPAYYMQAGDDFYKISSKDPFKLGAGIPLLKGVGDFKVRISTRSEFYEVQAEIKIMNMPDSKYSVKPGTKKLNPFLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.