NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194113_10057813

Scaffold Ga0194113_10057813


Overview

Basic Information
Taxon OID3300020074 Open in IMG/M
Scaffold IDGa0194113_10057813 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3685
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-6.1786Long. (o)29.658Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F002060Metagenome / Metatranscriptome597Y
F074876Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0194113_100578134F000473AGGAGVSLNDSQHFYDNNHFKYGINQWTGEPNKPVFYTEEMKKRVREIKKPMLLLMDVAIYPDFLALRLYEDNFLQFDGSKKEEVIDYVSKVKKLIESYGVRCELEGMPSGRVL
Ga0194113_100578135F074876GGAGGVEEYYELINIVYIYPEKVYGTVEQLGAFASMVKYQKDGTDYEVLLENDEFAIVDEIVFHHVEENNE
Ga0194113_100578136F000671GAGGMNKILCYSCNKNKHKLNAKKSSLLPINLLMCEACINAKLEPRWVIILAGRSSGADYVREFVLKKRYLGEEISASELLV
Ga0194113_100578137F002060AGGMDYTSIILAISAAILSGMGTAIVSGIRENRREKNRQSEREQDQLKLEVKDLKISLYKLERDLTEWKDKYYNAIQDLIVVKSELENALVQLNLIELNELDPEI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.