Scaffold Ga0197143_1011558

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0197143_1011558

Scaffold Ga0197143_1011558

Overview

Basic Information
Taxon OID	3300020139 Open in IMG/M
Scaffold ID	Ga0197143_1011558 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Great Boiling Springs, Gerlach, Nevada, United States - GBS 70_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3795
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (88.89%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	USA: Nevada
Coordinates	Lat. (^o)	40.6614	Long. (^o)	-119.3661	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020180	Metagenome / Metatranscriptome	225	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0197143_10115586	F020180	GGAGG	MNDERVRLWYTARCSCVKPIIYQERDRFPLRCARCGGHLYSAPRPPHFERMARTPIVDFRAILRLLGLGVLAVLGWLLVALMFIVFGGQP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.