NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196977_1000097

Scaffold Ga0196977_1000097


Overview

Basic Information
Taxon OID3300020146 Open in IMG/M
Scaffold IDGa0196977_1000097 Open in IMG/M
Source Dataset NameSoil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)55608
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)35 (85.37%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.305Long. (o)-116.2547Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096017Metagenome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0196977_100009738F096017AGGLSQVAGYKLEAFILNHRAAEMLPDNLRHLHRFRLSDHLTLVPVTRQLLQEVVETFGEYEAEDDPYEDSLLTRLLPPLIQMAVKVSSVSAVLYFEVDVAGGIGDRSAIVWHKGEAAYGPTWGTSQVAEAFRLFGQTEGLSPSWAVELRIYRHRFTEDWVKGSESGSD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.