NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211736_10839386

Scaffold Ga0211736_10839386


Overview

Basic Information
Taxon OID3300020151 Open in IMG/M
Scaffold IDGa0211736_10839386 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)810
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)4 to 10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F073544Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0211736_108393861F000671GAGGMEKILCYSCNKSKNKLSVRKSILIPINLLMCETCITAKFEPRWIIILSGRQLGPEAVKEFIVKKRYIGNDIAASELFV
Ga0211736_108393862F073544AGGVREYYEVIKIVFIHAERVYGSVESLGLYASKVKYQKDGIEIEEVLENDEFTIMDEIVFEHVEESN
Ga0211736_108393863F000473N/ALGKRLGLKMEFINKDKDHFKYGVNEWTGEPNKPVFYTPEMAKRIREIKKPDMALQMDIARYPEFLAIRLYEDNFVKYEGIKKEMVIDYVGKVKKLIESYGVRCELEGVPSARILRSN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.