NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0197142_1000729

Scaffold Ga0197142_1000729


Overview

Basic Information
Taxon OID3300020153 Open in IMG/M
Scaffold IDGa0197142_1000729 Open in IMG/M
Source Dataset NameSediment microbial communities from Great Boiling Springs, Gerlach, Nevada, United States - GBS 60_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)30590
Total Scaffold Genes45 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)32 (71.11%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Nevada
CoordinatesLat. (o)40.6614Long. (o)-119.3661Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011084Metagenome / Metatranscriptome295Y
F020180Metagenome / Metatranscriptome225Y
F020182Metagenome / Metatranscriptome225N
F096802Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0197142_100072927F020180GGAGGMNERVKYWYTARCSCVKPIIYQERDRYPQRCARCGGHLYSEPRAFHFERLSHTPIVDVRALLRLLGLGVLAVLALLWMAMVFIVFGGQP
Ga0197142_100072930F011084AGGGGGMRIKIHQNGYGDTIVCAEIEMRGRFDLVPAENWRELEPEARAYLEARGVKVSEMGTFECPEQIAARAKFGFELFWAQSGLFIGEALAEYRRRVLGEVDYARFAITNNLSPRTVELLEKYGRIPRRADTRARIERAYRLPAGFLNEFDG
Ga0197142_100072943F096802N/ALRYLHRHPLELSHLPAEAFIDLAALALAEAEAYEDAAGEL
Ga0197142_10007298F020182N/AMLHARYTACISSVSIGEIVSAVREERLQDAVRMLMQRECMVTVYARRVLRAELDGRIALLAPWDSAPALTRKLHALFGLPAPHEPCRDCPERGGFTS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.