NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0197142_1093604

Scaffold Ga0197142_1093604


Overview

Basic Information
Taxon OID3300020153 Open in IMG/M
Scaffold IDGa0197142_1093604 Open in IMG/M
Source Dataset NameSediment microbial communities from Great Boiling Springs, Gerlach, Nevada, United States - GBS 60_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)922
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Nevada
CoordinatesLat. (o)40.6614Long. (o)-119.3661Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056638Metagenome / Metatranscriptome137N

Sequences

Protein IDFamilyRBSSequence
Ga0197142_10936041F056638GGAGMPSSWLRRWRDAYYTENPVVWLLTKTESELCLRQISAPEPAETGSASSRLQLLKSDSVYSTRYFLWADEKEFERTLLAPWHLPSNRWMPVSDQIYLAFASLVTMTALVIHYALAKSPVWVGAVGVGFVVLAFFLPMARPMLALHSLAQTLTADTPLHIGVSRLTPAHLVYGALLYGVGRIARASAVYGILPALL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.