NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211733_10232123

Scaffold Ga0211733_10232123


Overview

Basic Information
Taxon OID3300020160 Open in IMG/M
Scaffold IDGa0211733_10232123 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2769
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (22.22%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005879Metagenome / Metatranscriptome387Y
F028509Metagenome / Metatranscriptome191Y
F051122Metagenome / Metatranscriptome144N
F058141Metagenome / Metatranscriptome135N

Sequences

Protein IDFamilyRBSSequence
Ga0211733_102321233F051122N/AMTNEEYKLQLSALKTTLEIVLIEGEKKGKEISVAYECGMYLGTIKAVISHLEELTNDSTG
Ga0211733_102321234F058141N/AMTILTHTNNMKIRIENIECRISHNQYEFVKWYPNKYFGTKAQLIADGYELQPIHDHGFVLTKGNHTIHDSCFLNPEGCYTIATIVYDKNEHCTEIKSVGSRLLDLTKNERMYFFEVYHYADKQIKKENKNKDND
Ga0211733_102321236F028509N/AMENKVKVSLVIQSHLKDAMVEVHHQELMDEGQERLRFVMYLIHYYPDTTQEILVDFVYEQFKQFGK
Ga0211733_102321237F005879N/AMIDNNVFWKEDFTDGVVKGGIYVRSFDLKKFLELVEANENGNGGEVVGLRFDGNNLEVLVKDLAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.