NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211733_10399850

Scaffold Ga0211733_10399850


Overview

Basic Information
Taxon OID3300020160 Open in IMG/M
Scaffold IDGa0211733_10399850 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2180
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000258Metagenome / Metatranscriptome1443Y
F001229Metagenome / Metatranscriptome741Y
F073145Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0211733_103998501F001229GAGMNSIVDSVLSMNLDVYRQSEIQDTDTGAIVREWNFYKTVPCHVKGVISNSATTRSSDKQIFSNKYLNDQVIQVRTAEKLTAREKVTNIRDSEGNTIWNEINYPNETPTVFEVMGTTPVTDPFGRVIAYNSSMKRSENQQIGQ
Ga0211733_103998503F000258GGAGGVTANYKLDAMLELRKYLWKELYTRNIFDEEDYWSDNLNENIVPIIPVQQAAEMNQFLSGKKHIVYDKIGMSYEDNWLICCEQIMFTLYSTSVADINEIRNYMTDEFRRMDESAKDINKWTDLSNKFKFHSIWIADISPTAPSEELQGFFSAEVILEIKYSRITDNVGRFL
Ga0211733_103998504F073145AGGAGGMAQSVGNAKNILVGASPLFLSNIDINDSDYQANAEAGVKFPASATGSSIRVPAFSSGESYTTTLNAIDQTSGTFGYRNVGFTNNGLQITYNPTYDSV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.